SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83269966|ref|YP_419257.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83269966|ref|YP_419257.1|
Domain Number 1 Region: 35-388
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-43
Family L-arabinose binding protein-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|83269966|ref|YP_419257.1|
Sequence length 393
Comment branched chain amino acid ABC transporter substrate-binding protein [Brucella melitensis biovar Abortus 2308]
Sequence
MKPIKDTCLLVAGMALGLWAFATAAQATPTCKNGPIQLGAVSTVTGVVDFSDAPKAAAAV
FKQLNDAGGINGCKIDYSIADDKGDPQVAAQAARDLIDNKAVVALAGGASLLDCAVNAAT
YNRNDVLDVQGVGVDPLCFNAPSIAPVNVGPYTLTTVMLDYAMKNLGAKKLCAFFLVIGG
TQEAYANAVSSWEEASGNKIALIDMTLPAQGDLTPYVIKARNAGCDAVLTNQVEPGVVQW
IKTVDAQKVQGINWLFLAPGYTEGVAKALADSKQPIYVGTEWEPYTEASEANADWIKTMD
KAGLAKTAFSQGGYLAAKVMIDTISGIDGEVTREAVTQALKQGKELHYPMAGSPYVFGEA
KAHSPMQATKVMQLDAGKWTVKTNDWFSLSKAD
Download sequence
Identical sequences A0A0E1WXW8 A0A0F6AVZ0 A0A0H3GC30 A0A0M1WGB3 A0A2D2BV47 A0A2K4NR20 A9MD94 A9WXA6 C0G8U0 C4IWX1 C7LJU1 D0RD21 Q2YJC7 Q576F3
gi|256015932|ref|YP_003105941.1| gi|376270518|ref|YP_005113563.1| gi|23500886|ref|NP_700326.1| WP_002967142.1.100018 WP_002967142.1.100204 WP_002967142.1.100443 WP_002967142.1.101247 WP_002967142.1.102082 WP_002967142.1.10307 WP_002967142.1.10630 WP_002967142.1.1158 WP_002967142.1.11620 WP_002967142.1.11769 WP_002967142.1.12241 WP_002967142.1.13020 WP_002967142.1.13460 WP_002967142.1.13576 WP_002967142.1.13592 WP_002967142.1.13826 WP_002967142.1.14633 WP_002967142.1.15325 WP_002967142.1.16733 WP_002967142.1.16975 WP_002967142.1.17733 WP_002967142.1.1800 WP_002967142.1.19508 WP_002967142.1.19641 WP_002967142.1.19645 WP_002967142.1.20012 WP_002967142.1.2214 WP_002967142.1.22340 WP_002967142.1.22583 WP_002967142.1.24196 WP_002967142.1.24428 WP_002967142.1.24496 WP_002967142.1.24655 WP_002967142.1.2483 WP_002967142.1.25382 WP_002967142.1.25561 WP_002967142.1.26599 WP_002967142.1.27052 WP_002967142.1.2778 WP_002967142.1.2839 WP_002967142.1.2874 WP_002967142.1.31106 WP_002967142.1.31239 WP_002967142.1.31463 WP_002967142.1.32337 WP_002967142.1.33599 WP_002967142.1.33753 WP_002967142.1.3390 WP_002967142.1.34225 WP_002967142.1.35970 WP_002967142.1.3681 WP_002967142.1.38343 WP_002967142.1.38790 WP_002967142.1.38925 WP_002967142.1.39039 WP_002967142.1.39963 WP_002967142.1.40138 WP_002967142.1.40407 WP_002967142.1.40624 WP_002967142.1.40649 WP_002967142.1.408 WP_002967142.1.40871 WP_002967142.1.41044 WP_002967142.1.41835 WP_002967142.1.41893 WP_002967142.1.41941 WP_002967142.1.41950 WP_002967142.1.42427 WP_002967142.1.43006 WP_002967142.1.43359 WP_002967142.1.43583 WP_002967142.1.43597 WP_002967142.1.43689 WP_002967142.1.43928 WP_002967142.1.4428 WP_002967142.1.44294 WP_002967142.1.44793 WP_002967142.1.44949 WP_002967142.1.44989 WP_002967142.1.45546 WP_002967142.1.45559 WP_002967142.1.46182 WP_002967142.1.46432 WP_002967142.1.47558 WP_002967142.1.47610 WP_002967142.1.48744 WP_002967142.1.49427 WP_002967142.1.49542 WP_002967142.1.49753 WP_002967142.1.49953 WP_002967142.1.50051 WP_002967142.1.50053 WP_002967142.1.50282 WP_002967142.1.5052 WP_002967142.1.52027 WP_002967142.1.5236 WP_002967142.1.53128 WP_002967142.1.53481 WP_002967142.1.5394 WP_002967142.1.54440 WP_002967142.1.54776 WP_002967142.1.54779 WP_002967142.1.55440 WP_002967142.1.55684 WP_002967142.1.56313 WP_002967142.1.56334 WP_002967142.1.56683 WP_002967142.1.56952 WP_002967142.1.57564 WP_002967142.1.57925 WP_002967142.1.58260 WP_002967142.1.58539 WP_002967142.1.58868 WP_002967142.1.59086 WP_002967142.1.59091 WP_002967142.1.5971 WP_002967142.1.59985 WP_002967142.1.60631 WP_002967142.1.61536 WP_002967142.1.61811 WP_002967142.1.61997 WP_002967142.1.62592 WP_002967142.1.62872 WP_002967142.1.63730 WP_002967142.1.63732 WP_002967142.1.64013 WP_002967142.1.64124 WP_002967142.1.64849 WP_002967142.1.64853 WP_002967142.1.64905 WP_002967142.1.65131 WP_002967142.1.65299 WP_002967142.1.65454 WP_002967142.1.65651 WP_002967142.1.66078 WP_002967142.1.66260 WP_002967142.1.66340 WP_002967142.1.66810 WP_002967142.1.67402 WP_002967142.1.67893 WP_002967142.1.67996 WP_002967142.1.67997 WP_002967142.1.68488 WP_002967142.1.69829 WP_002967142.1.70296 WP_002967142.1.70322 WP_002967142.1.71002 WP_002967142.1.71194 WP_002967142.1.71846 WP_002967142.1.72533 WP_002967142.1.72916 WP_002967142.1.74005 WP_002967142.1.75434 WP_002967142.1.75458 WP_002967142.1.76350 WP_002967142.1.76433 WP_002967142.1.77165 WP_002967142.1.77321 WP_002967142.1.77683 WP_002967142.1.77899 WP_002967142.1.78109 WP_002967142.1.78716 WP_002967142.1.7984 WP_002967142.1.79963 WP_002967142.1.8012 WP_002967142.1.80266 WP_002967142.1.80365 WP_002967142.1.80697 WP_002967142.1.81558 WP_002967142.1.81617 WP_002967142.1.82113 WP_002967142.1.8223 WP_002967142.1.8224 WP_002967142.1.8278 WP_002967142.1.8307 WP_002967142.1.83161 WP_002967142.1.83513 WP_002967142.1.84512 WP_002967142.1.85721 WP_002967142.1.8657 WP_002967142.1.86923 WP_002967142.1.87603 WP_002967142.1.87867 WP_002967142.1.87893 WP_002967142.1.88404 WP_002967142.1.8878 WP_002967142.1.90420 WP_002967142.1.90689 WP_002967142.1.91123 WP_002967142.1.91338 WP_002967142.1.91710 WP_002967142.1.91958 WP_002967142.1.92518 WP_002967142.1.9303 WP_002967142.1.93230 WP_002967142.1.93367 WP_002967142.1.93454 WP_002967142.1.93795 WP_002967142.1.94126 WP_002967142.1.94770 WP_002967142.1.94775 WP_002967142.1.97511 WP_002967142.1.98076 WP_002967142.1.98362 WP_002967142.1.98455 WP_002967142.1.98704 WP_002967142.1.99373 WP_002967142.1.99421 gi|189023241|ref|YP_001932982.1| gi|376279108|ref|YP_005109141.1| gi|376277318|ref|YP_005153379.1| gi|163845489|ref|YP_001623144.1| gi|23500886|ref|NP_700326.1| gi|340792928|ref|YP_004758392.1| gi|62317989|ref|YP_223842.1| gi|83269966|ref|YP_419257.1| gi|161621216|ref|YP_001595102.1| 204722.BRA1173 262698.BruAb2_1109 359391.BAB2_1132 430066.BAbS19_II10560 470137.BSUIS_B1403 483179.BCAN_B1204 568815.BMI_II1179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]