SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83269792|ref|YP_419083.1| from Brucella melitensis biovar Abortus 2308

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83269792|ref|YP_419083.1|
Domain Number 1 Region: 68-326
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.33e-27
Family L-arabinose binding protein-like 0.0033
Further Details:      
 
Domain Number 2 Region: 9-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000419
Family GalR/LacI-like bacterial regulator 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83269792|ref|YP_419083.1|
Sequence length 351
Comment transcriptional regulator LacI [Brucella melitensis biovar Abortus 2308]
Sequence
MHISRKKATIYDLSVLSGSSPSTVSAVLNGTWRKRRISQATAEAILQLADQHAYTANRQA
QGLRHSRSGLVGLLLPLHDNRFFSAMAQIFEAHVRARSFCPVVVSASRDPEEERETAETL
ISYAIDELFICGATDPDGLHELCEKAALPHVNIDLPGSRAPSVTTDNFAGGKMLTAAIIE
YFGEEAPLQPEDLCLFGGRNDESTRQRICGFHQVKQTVLGADPEGCVFKTGYSPANTLVA
LNDYRARHGRLPRGLFVNSSINLEGLLRFMAEHPGEPLNDIVIGCYDYDPFASFLPFPVI
SILQDVEGMIAKAFDLMERRVTEPELHLIMPKLIAPRSAITGPLDSLKDIK
Download sequence
Identical sequences A0A0M1WI76 A0A2I7WW45 B0ZTD0 D7H4Y7 Q2YJV1 Q576Y2
gi|376271475|ref|YP_005114520.1| 262698.BruAb2_0916 359391.BAB2_0940 430066.BAbS19_II08690 gi|189023063|ref|YP_001932804.1| gi|62317810|ref|YP_223663.1| gi|83269792|ref|YP_419083.1| WP_002966323.1.100443 WP_002966323.1.101965 WP_002966323.1.102082 WP_002966323.1.10322 WP_002966323.1.10630 WP_002966323.1.10893 WP_002966323.1.11620 WP_002966323.1.12041 WP_002966323.1.12241 WP_002966323.1.13460 WP_002966323.1.13826 WP_002966323.1.14542 WP_002966323.1.14633 WP_002966323.1.15077 WP_002966323.1.16975 WP_002966323.1.17378 WP_002966323.1.18034 WP_002966323.1.18635 WP_002966323.1.19641 WP_002966323.1.20012 WP_002966323.1.22583 WP_002966323.1.2337 WP_002966323.1.24196 WP_002966323.1.24428 WP_002966323.1.24655 WP_002966323.1.24726 WP_002966323.1.25101 WP_002966323.1.25382 WP_002966323.1.25729 WP_002966323.1.26599 WP_002966323.1.2778 WP_002966323.1.2839 WP_002966323.1.2874 WP_002966323.1.2877 WP_002966323.1.28889 WP_002966323.1.31239 WP_002966323.1.32337 WP_002966323.1.32492 WP_002966323.1.32731 WP_002966323.1.33220 WP_002966323.1.33599 WP_002966323.1.33753 WP_002966323.1.34353 WP_002966323.1.35056 WP_002966323.1.35970 WP_002966323.1.37797 WP_002966323.1.38353 WP_002966323.1.39021 WP_002966323.1.39039 WP_002966323.1.39963 WP_002966323.1.40407 WP_002966323.1.40624 WP_002966323.1.40649 WP_002966323.1.40871 WP_002966323.1.41044 WP_002966323.1.41311 WP_002966323.1.42103 WP_002966323.1.42427 WP_002966323.1.43597 WP_002966323.1.4428 WP_002966323.1.45559 WP_002966323.1.46182 WP_002966323.1.46432 WP_002966323.1.4727 WP_002966323.1.47558 WP_002966323.1.47610 WP_002966323.1.4847 WP_002966323.1.49640 WP_002966323.1.50051 WP_002966323.1.50053 WP_002966323.1.50282 WP_002966323.1.5052 WP_002966323.1.5236 WP_002966323.1.53128 WP_002966323.1.53481 WP_002966323.1.5394 WP_002966323.1.54440 WP_002966323.1.55440 WP_002966323.1.55684 WP_002966323.1.56334 WP_002966323.1.56952 WP_002966323.1.57925 WP_002966323.1.58525 WP_002966323.1.58539 WP_002966323.1.59086 WP_002966323.1.59515 WP_002966323.1.61325 WP_002966323.1.61536 WP_002966323.1.61811 WP_002966323.1.61997 WP_002966323.1.63730 WP_002966323.1.64124 WP_002966323.1.64853 WP_002966323.1.64905 WP_002966323.1.65131 WP_002966323.1.65454 WP_002966323.1.66260 WP_002966323.1.66810 WP_002966323.1.67893 WP_002966323.1.67996 WP_002966323.1.67997 WP_002966323.1.68913 WP_002966323.1.69451 WP_002966323.1.69829 WP_002966323.1.70322 WP_002966323.1.71194 WP_002966323.1.71689 WP_002966323.1.71846 WP_002966323.1.7206 WP_002966323.1.72916 WP_002966323.1.75458 WP_002966323.1.75766 WP_002966323.1.76350 WP_002966323.1.76433 WP_002966323.1.77321 WP_002966323.1.78109 WP_002966323.1.7984 WP_002966323.1.79963 WP_002966323.1.80266 WP_002966323.1.80476 WP_002966323.1.80697 WP_002966323.1.81617 WP_002966323.1.81822 WP_002966323.1.8224 WP_002966323.1.8278 WP_002966323.1.8307 WP_002966323.1.85322 WP_002966323.1.85769 WP_002966323.1.8657 WP_002966323.1.87522 WP_002966323.1.87603 WP_002966323.1.87867 WP_002966323.1.8788 WP_002966323.1.8878 WP_002966323.1.90689 WP_002966323.1.91123 WP_002966323.1.91338 WP_002966323.1.92518 WP_002966323.1.93454 WP_002966323.1.94126 WP_002966323.1.94555 WP_002966323.1.94775 WP_002966323.1.97511 WP_002966323.1.97741 WP_002966323.1.98076 WP_002966323.1.98455 WP_002966323.1.99221 WP_002966323.1.99373 WP_002966323.1.99421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]