SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008580 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008580
Domain Number 1 Region: 5-221
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.35e-63
Family D-ribulose-5-phosphate 3-epimerase 0.00000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008580   Gene: ENSCSAVG00000005101   Transcript: ENSCSAVT00000008690
Sequence length 231
Comment pep:novel reftig:CSAV2.0:reftig_99:790804:796112:1 gene:ENSCSAVG00000005101 transcript:ENSCSAVT00000008690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAYQCKIGPSILNSDLARLGDECKRMLECGADYLHLDVMDGHFVPNITFGHPVVQCIRK
SIGDSPVCEVHMMVSKPEQWVKAMAESGANIYTFHLEAAENAEQLIKDIRMEGMKAGCAI
KPATPVSKLLDLLYTQMADVALVMTVEPGFGGQSFMRPMMEKVRELRKVHPTLDIGVDGG
VGPNCIHHCAEAGANMIVSGSAIMRSNDPRKVITDLRNVVQEVIQQTTLER
Download sequence
Identical sequences H2YTC0
ENSCSAVP00000008580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]