SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008582 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008582
Domain Number 1 Region: 3-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.47e-63
Family D-ribulose-5-phosphate 3-epimerase 0.00000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008582   Gene: ENSCSAVG00000005101   Transcript: ENSCSAVT00000008692
Sequence length 229
Comment pep:novel reftig:CSAV2.0:reftig_99:790860:795617:1 gene:ENSCSAVG00000005101 transcript:ENSCSAVT00000008692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYQCKIGPSILNSDLARLGDECKRMLECGADYLHLDVMDGHFVPNITFGHPVVQCIRKSI
GDSPVCEVHMMVSKPEQWVKAMAESGANIYTFHLEAAENAEQLIKDIRMEGMKAGCAIKP
ATPVSKLLDLLYTQMADVALVMTVEPGFGGQSFMRPMMEKVRELRKVHPTLDIGVDGGVG
PNCIHHCAEAGANMIVSGSAIMRSNDPRKVITDLRNDISSRLKTQHLID
Download sequence
Identical sequences H2YTC2
ENSCSAVP00000008582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]