SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008583 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008583
Domain Number 1 Region: 3-236
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 8.07e-59
Family D-ribulose-5-phosphate 3-epimerase 0.0000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008583   Gene: ENSCSAVG00000005101   Transcript: ENSCSAVT00000008693
Sequence length 240
Comment pep:novel reftig:CSAV2.0:reftig_99:790861:795516:1 gene:ENSCSAVG00000005101 transcript:ENSCSAVT00000008693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYQCKIGPSILNSDLARLGDECKRMLECGADYLHLDVMDGHFVPNITFGHPVVQCTRKEH
QTSKTKTELQRFKKNTMNACVIFRLHMMVSKPEQWVKAMAESGANIYTFHLEAAENAEQL
IKDIRMEGMKAGCAIKPATPVSKLLDLLYTQMADVALVMTVEPGFGGQSFMRPMMEKVRE
LRKVHPTLDIGVDGGVGPNCIHHCAEAGANMIVSGSAIMRSNDPRKVITDLRNVVQEVIQ
Download sequence
Identical sequences H2YTC3
51511.ENSCSAVP00000008583 ENSCSAVP00000008583 ENSCSAVP00000008583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]