SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000009264 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000009264
Domain Number 1 Region: 8-200
Classification Level Classification E-value
Superfamily PRTase-like 2.62e-45
Family Phosphoribosyltransferases (PRTases) 0.00067
Further Details:      
 
Domain Number 2 Region: 240-358
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.48e-24
Family Decarboxylase 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000009264   Gene: ENSCSAVG00000005465   Transcript: ENSCSAVT00000009381
Sequence length 372
Comment pep:known reftig:CSAV2.0:reftig_60:307321:314036:1 gene:ENSCSAVG00000005465 transcript:ENSCSAVT00000009381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEVKTEDLILELFKVSALKFGEFKLKTGIISPVYVDLRVVVSYPSLMVKISELLWQTC
DKLGISYNCVCGVPYTALPLATCICASHNIPMLIRRKEAKDYGTKKMLEGVYKDGDRCLI
VEDVVTSGSSVQETVELLNEHGLTVTDAVVLLNREQGGQSNLKHRGVNLISVLTLTQVVD
TLSQHGKIEKSDVNKVKEFIAANDLSNKENCNGDNKKSQTVFPDKSTHEKIYKSVTGIGS
SYRERGSNCKHNLAAKIFHIMEEKQTNLCLSADVESSVELLELAETLGPMLCAIKTHVDI
LVDFSYSVVKKLVEISKKHNFVIFEDRKFADTGNTVKLQYSGGLYKISEWSDLTNGHVIH
RGQGLYKDSKPV
Download sequence
Identical sequences H2YVA4
ENSCSAVP00000009264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]