SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000009266 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000009266
Domain Number 1 Region: 212-453
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.03e-48
Family Decarboxylase 0.000000609
Further Details:      
 
Domain Number 2 Region: 2-178
Classification Level Classification E-value
Superfamily PRTase-like 5.96e-42
Family Phosphoribosyltransferases (PRTases) 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000009266   Gene: ENSCSAVG00000005465   Transcript: ENSCSAVT00000009383
Sequence length 455
Comment pep:known reftig:CSAV2.0:reftig_60:307397:313495:1 gene:ENSCSAVG00000005465 transcript:ENSCSAVT00000009383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVSALKFGEFKLKTGIISPVYVDLRVVVSYPSLMVKISELLWQTCDKLGISYNCVCGVPY
TALPLATCICASHNIPMLIRRKEAKDYGTKKMLEGVYKDGDRCLIVEDVVTSGSSVQETV
ELLNEHGLTVTDAVVLLNREQGGQSNLKHRGVNLISVLTLTQVVDTLSQHGKIEKSDTTK
RVKQFSLTSRPMRKFTKVSLALGPRTEKEEVTANTTAKIFHIMEEKQTNLCLSADVESSV
ELLELAETLGPMLCAIKTHVDILVDFSYSVVKKLVEISKKHNFVIFEDRKFADTGNTVKL
QYSGGLYKISEWSDLTNGHVIGPGVIQGLQACVREKPDKACLLIAGMSTKGNLTNAAYSD
ATVQMAEDHPDFVIGFICTTKVSTNPSHLHFTPGVKLQTGGDSLGQQYLTPEEVIGKRGV
DVIIVGRGIVESENRVKTAAAYRSAGWQAYLQRLH
Download sequence
Identical sequences H2YVA6
ENSCSAVP00000009266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]