SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000009854 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000009854
Domain Number 1 Region: 3-268
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.96e-28
Family Tryptophan biosynthesis enzymes 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000009854   Gene: ENSCSAVG00000005791   Transcript: ENSCSAVT00000009972
Sequence length 278
Comment pep:known reftig:CSAV2.0:reftig_54:233917:236259:-1 gene:ENSCSAVG00000005791 transcript:ENSCSAVT00000009972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRKFVDVFQKSKGVIIGMVHLRALPGSTPKNNLCVTQICDIALKEAEIYINAGLDGIMIE
NMHDVPYKKNNLIGPEITAAMATVGSKLRTNFSEIPIGVQILTAANQEALAVAKCCDLDF
MRAEGFVFSHIGDEGIIDSCAGSLLRYRKQLNAENVLVFADVKKKHSSHAITSDTSVAET
SQAAEFFLADGVIITGSQTGVSADPLQLQDVQNQVEIPVLVGSGVSVENIENFIRCSALV
IGSHFKVGGFWGNDVDVHRVEDFMNRVRHWELRCNVNS
Download sequence
Identical sequences H2YWZ3
ENSCSAVP00000009854 ENSCSAVP00000009854 51511.ENSCSAVP00000009854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]