SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000012309 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000012309
Domain Number 1 Region: 315-442
Classification Level Classification E-value
Superfamily Plus3-like 1.15e-42
Family Plus3 0.00000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000012309   Gene: ENSCSAVG00000007241   Transcript: ENSCSAVT00000012452
Sequence length 663
Comment pep:known reftig:CSAV2.0:reftig_17:1157175:1165534:1 gene:ENSCSAVG00000007241 transcript:ENSCSAVT00000012452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKMSKRRKNRVVSDSDESSAEEDSLSAESSTKRPRNDSINDAPKAKVVATTTTNTSDSDT
SDDDDEWTVGGKSKKKKTTKKVIRGRKSKFGMSKETVSDESSGDDSGSDDAMPNLSSSED
SEPQSDADGSESEFDEEALWKEFDDGYDSELVGDEEDRARLENMTEKEREQELYNRLEKR
EALQKRFEIEKKLRLAKMQSSDKRKKKKKSSKLPKKNSFNSLLPSRNDRRRKVEDKKEKI
LGDLRAEIERKKNKAIKNKQILKASEVYSDDDDDDEDDGISGSDSDSDISRKAGSMDEDD
DRTSNSKRFQPISCKEDLARIRLSRFKLEKWVHLPFFKETCSGCFVRIGIGNNNGRPVYR
IAEIIDVVETAKVYQLGKTRTNKGLRLRHGQQERVFRLEFVSNSEFSDTEFSKWKEAVML
AGLDLPTLDEIQKKQSSMHKAVQYNIKDADIDHIIKEKKKFRKNPFNYAMKKTTLLKQKE
MAEGQGDGDETKRINSQLDELEERASHLDKQRQENIAGITYINERIKSHNLLKEEACKEE
WKVLRKTAADPFTRRRCKPVLVSNAEDGEQTQRLLQEMEKRYGGNVAYDIPKIGKAIKSP
KESDKKESGDLFDAHDFDIKLDLQMPAAERSLVAPKVSTATTSSDAPRRSLNLADYKKRR
GLI
Download sequence
Identical sequences H2Z3Z7
51511.ENSCSAVP00000012309 ENSCSAVP00000012309 ENSCSAVP00000012309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]