SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000109 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000109
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.04e-32
Family Forkhead DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000109   Gene: ENSCSAVG00000000053   Transcript: ENSCSAVT00000000110
Sequence length 108
Comment pep:novel reftig:CSAV2.0:reftig_56:349983:351973:-1 gene:ENSCSAVG00000000053 transcript:ENSCSAVT00000000110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVDDVRPLYSYIALIAMAIYSNEKRKETLNGIYRFISGNFPYYRRNHRAWQNSIRHNLSL
NACFVKVNRESDDPPGKGHYWTFAAGSPEVFALFENNPIGGSAKRKPK
Download sequence
Identical sequences H2Y461
ENSCSAVP00000000109 51511.ENSCSAVP00000000109 ENSCSAVP00000000109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]