SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000003935 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000003935
Domain Number 1 Region: 17-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000653
Family PCI domain (PINT motif) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000003935   Gene: ENSCSAVG00000002330   Transcript: ENSCSAVT00000003994
Sequence length 104
Comment pep:novel reftig:CSAV2.0:reftig_85:572194:573626:1 gene:ENSCSAVG00000002330 transcript:ENSCSAVT00000003994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLCLMEMTFARPSNNRHLKFADIASNTGIPLEEVEILTMKAMSLGLVRGSIDQVLEEVH
MHWVQPRVLNKQQVVKMKDKLATWCDEVTSMGSLVSSSAQDILT
Download sequence
Identical sequences H2YF37
51511.ENSCSAVP00000003935 ENSCSAVP00000003935 ENSCSAVP00000003935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]