SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000004972 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000004972
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.88e-21
Family DNA replication factor Cdt1 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000004972   Gene: ENSCSAVG00000002961   Transcript: ENSCSAVT00000005042
Sequence length 120
Comment pep:known reftig:CSAV2.0:reftig_21:125558:128910:1 gene:ENSCSAVG00000002961 transcript:ENSCSAVT00000005042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHSADTVVSMMFNRQQTTTWIKLQQAVKDMIKKKFELRDLGRIKHVFPGAYVYRQERGI
PTYDDRIKSTDYQLTIEPILTEEECDRASDEPRKLDSGLLVMRRHHFHLQLLSMVKHHHK
Download sequence
Identical sequences H2YI23
ENSCSAVP00000004972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]