SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000006674 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000006674
Domain Number 1 Region: 9-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.68e-33
Family Forkhead DNA-binding domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000006674   Gene: ENSCSAVG00000004000   Transcript: ENSCSAVT00000006760
Sequence length 116
Comment pep:novel reftig:CSAV2.0:reftig_463:192959:194937:1 gene:ENSCSAVG00000004000 transcript:ENSCSAVT00000006760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPQQPKVFPKPVYSYSCLIAMSLRHSKMGCLPVSDIYSYMMENFPYFKTAPDGWKNSVRH
NLSLNKCFEKVEKASGTQRKGCLWAMNPAKIGKMEEEVQKWKRKDPEAIRTEHCSS
Download sequence
Identical sequences H2YMX2
ENSCSAVP00000006674 51511.ENSCSAVP00000006674 ENSCSAVP00000006674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]