SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000009292 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000009292
Domain Number 1 Region: 231-352
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.86e-30
Family cAMP-binding domain 0.00036
Further Details:      
 
Domain Number 2 Region: 13-230
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.43e-29
Family Voltage-gated potassium channels 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000009292   Gene: ENSCSAVG00000005479   Transcript: ENSCSAVT00000009409
Sequence length 420
Comment pep:novel reftig:CSAV2.0:reftig_17:648591:654561:1 gene:ENSCSAVG00000005479 transcript:ENSCSAVT00000009409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKKSKTRHWVIDPAEGFYFWWLLIITLAVFYNLSLVIARSCFKALQKENYLVWLPFDYAC
DIIYIFDMVVRQKTGFFEQGLLVKDKDRLKKAYRSSFQYYIDLISILPTDLGYIFFGIHQ
LELRFNRVLRISRMFECFERVETRTTYPNLFRISILVFYIIIIIHWNACIFYALSRAIGF
GSDGWVYPDPAIPPFDTLSRKYVYSLYWSTLTLTTIGETPMPEKDIEYLFQVRKIYIFKD
CEPGLLIELVLKLRPQVFSPGDYVCRKGDVGKEMYIVKEGKLGVVGDDGITQYAVLGDGA
YFGEISILNITGNKTGNRRTANVRSIGYTDLFCLSKDDLLEVLSEYPGAKSVLEEKGRRM
LMKDGLVNQQDGEPGLDEQAALQRVEEMERRFGKLQIKFSRMTAENASSQQKLKQRINEL
Download sequence
Identical sequences H2YVD2
ENSCSAVP00000009292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]