SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000013838 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000013838
Domain Number 1 Region: 1486-1698
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000124
Family Tropomyosin 0.0021
Further Details:      
 
Domain Number 2 Region: 1175-1405
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000392
Family Tropomyosin 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000013838
Domain Number - Region: 1695-1867
Classification Level Classification E-value
Superfamily Tropomyosin 0.00137
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number - Region: 504-738
Classification Level Classification E-value
Superfamily Tropomyosin 0.00144
Family Tropomyosin 0.0022
Further Details:      
 
Domain Number - Region: 779-887
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00188
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000013838   Gene: ENSCSAVG00000008114   Transcript: ENSCSAVT00000013998
Sequence length 1974
Comment pep:novel reftig:CSAV2.0:reftig_15:1564080:1584743:1 gene:ENSCSAVG00000008114 transcript:ENSCSAVT00000013998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRSVGARVREIITENLREPDRSGLNQPDPVMSQISIILQEEIRMLQGELNRVEDLLSQAR
ADRDEVAIKYNAVSERLEQALKLEKGERDKGSMENKTLSMQNAVLKQKLEDEQTSYKRKL
QAYQEGQQRQAQLVQKLQSKVLQYKKKCGDLEEEVANRLDSTEARLRRTEASHTTDLEDA
LIKLEEEKQRCESLAEVNSMLREQLVSANDSNAALADDLRKVTEDWNNVRQELKTKEADW
REEQENFSSFFGDEHSRLLALWRSVVQIRRGFGDLKSTTQRDLAQAINDVQRGARQLHAS
CLNLNSNQSVQDTSAKVSLERERDEKIDVEEQLRRKVKEMLTMQSNFDAEKARLNGKINE
LTVSHERAMSQLSEKDRHISELRTPARQLESTRVDGGAGEDEETAAYIAAEKLGLEKALR
DIAQSVIADADLAMALSDSPRASAVDDLTESMADLGIGHSPRSSSPGRRSPRRGRSPGIR
GVSPSFADSTYNAVQAALQKRQLQVQELRAKLEAARDAAASLKKQCGDSDNERNAMEAQL
MALREELDNTTRAKDDAKRDAYRYKSNAEVVGSEKQEIGKAREGLQQRIDALVSEKQKLQ
AANAELQRQRDNVEDEKEDLLKDLKRKEMELQRGKNTVDNMDGKHSSLRERLATTKEALN
RATLEKEIMEAEKAEVVEALSKVERTNAEIELAFNKLKTEEASLRDQLAKMQALNEGLAQ
DKVDLHKVIAEMEEKFAALGAAKHDLALEKDSIRAELIKTEQEKMDLHNEKTGLDHSLIL
TEQSREKLEQDLMALHREKAEFSDSLTQCTRAKAGVEEELEKCREDISRLNDLGNKLARE
KEELTKEKANLIVQLTATERENRTLSEEMAGLRADKEALETNLFDVQNVAATLEAKKEQL
EEVNQNGMMKNESLQVEIGRVRKEMEVETAKLQRDIQLLNQAMIQQEREAQVALKNEQQS
HEEDLEKASQEKSTLRLALQAEKEELLHTGNLDKEDIMSKYEAEKQELQEEIEAISQEHN
EALIMAEAEKQQCLLIKETEKNALQEKLANAIQTIQELENEYEKQKRQANSKTEKDRATI
NQITQELKDFRTQFELATEAHEREIKGLNDACKQVHSMRDAALKEVEDLKLQLRMAEDAR
DGVRRDLIEAQRKVRETEEARDRQRKENLELKRAINDESHEKQTISKGNEQLRTQVKKAE
QERISLKRSNEEKDQKIVVLDESRGNTQRENADLRASLREVERSRLEARRELQELRRQVK
MLDSENTKKSKEVEDLQSRVSNDEEREEESRRESFGLKQKIVATEASKEQALKENSMLQR
KLAELEDDNRNKERDYLEQLGESHTSIKRQKDEIRNLVIKTDELDEQLAENKLKLSASEG
RVNGLENEIVKIEANKRDVEFKLGSLHSALRRTLGISRLGRTMSPMRGSYRSPSSSPHRS
KSPGKGFDNTFTTTTDGKGTPIPSTGSPDRNRNIDPEVVRAALRDFLQELKDTQREKDDT
KIEVSNLTRQLMEMEADRDRVNQRLQQLQKSLGEAEEGKRGAHGRLASAQTALMLQEETI
RRNEREAKATAEKLAQLERTQQNSEVERRTLQDKINKMKAQGAKCEAEKRKLKEAFEASE
QRATKLELARRSLEGDYQRSKLSLTDKETSSQVQQERIANLSAQIQDLEGKCTSLQLTID
RLSNALAKTEEGESSLKDKVQSLSLSMSEKEAAATSLHDKISQLQKMLTASEHDRRVLQE
RLQAARQTLTDLKKQNAALQERVQSSTHEMEDSEVRRSELENQSKSLQQMIAQHQEAEAG
GLERIQKLQEEKRILQERITGLQRAIAQLDSEKRETQRGAVRLEKDKTALQKTLDKVERE
RLKTEEESIKLADTKGLLNRSLRDMESEMDDARKTIQALQVQLADSEQTSAQRLIDVTSR
HRQESELEMERLRTAQVQTERTLEARERAHRQRVKGLEEQVATLKDQLTQEIRR
Download sequence
Identical sequences H2Z8C6
ENSCSAVP00000013838 51511.ENSCSAVP00000013838 ENSCSAVP00000013838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]