SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000013839 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000013839
Domain Number 1 Region: 1448-1662
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000105
Family Tropomyosin 0.0021
Further Details:      
 
Domain Number 2 Region: 1135-1365
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000327
Family Tropomyosin 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000013839
Domain Number - Region: 1657-1865
Classification Level Classification E-value
Superfamily Tropomyosin 0.000222
Family Tropomyosin 0.0028
Further Details:      
 
Domain Number - Region: 464-698
Classification Level Classification E-value
Superfamily Tropomyosin 0.00144
Family Tropomyosin 0.0022
Further Details:      
 
Domain Number - Region: 738-847
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00254
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000013839   Gene: ENSCSAVG00000008114   Transcript: ENSCSAVT00000013999
Sequence length 1936
Comment pep:novel reftig:CSAV2.0:reftig_15:1564431:1584743:1 gene:ENSCSAVG00000008114 transcript:ENSCSAVT00000013999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQEEIRMLQGELNRVEDLLSQARADRDEVAIKYNAVSERLEQALKLEKGERDKGSMENKT
LSMQNAVLKQKLEDEQTSYKRKLQAYQEGQQRQAQLVQKLQSKVLQYKKKCGDLEEEVAN
RLDSTEARLRRTEASHTTDLEDALIKLEEEKQRCESLAEVNSMLREQLVSANDSNAALAD
DLRKVTEDWNNVRQELKTKEADWREEQENFSSFFGDEHSRLLALWRSVVQIRRGFGDLKS
TTQRDLAQAINDVQRGARQLHASCLNLNSNQSVQDTSAKVSLERERDEKIDVEEQLRRKV
KEMLTMQSNFDAEKARLNGKINELTVSHERAMSQLSEKDRHISELRTPARQLESTRVDGG
AGEDEETAAYIAAEKLGLEKALRDIAQSVIADADLAMALSDSPRASANSSSDDSGRPYSP
MRSSSPGRRSPRRGRSPGIRGVSPSFADSTYNAVQAALQKRQLQVQELRAKLEAARDAAA
SLKKQCGDSDNERNAMEAQLMALREELDNTTRAKDDAKRDAYRYKSNAEVVGSEKQEIGK
AREGLQQRIDALVSEKQKLQAANAELQRQRDNVEDEKEDLLKDLKRKEMELQRGKNTVDN
MDGKHSSLRERLATTKEALNRATLEKEIMEAEKAEVVEALSKVERTNAEIELAFNKLKTE
EASLRDQLAKMQALNEGLAQDKVDLHKVIAEMEEKFAALGAAKHDLALEKDSIRAELIKT
EQEKMDLHNEKTGLDHSLILTEQSREKLEQDLMALHREKAEFSDSLTQCTRAKAGVEEEL
EKCREDISRLNDLGNKLAREKEELTKEKANLIVQLTATERENRTLSEEMAGLRADKEALE
TNLFDVQNVAATLEAKKEQLEEVNQNGMMKNESLQVEIGRVRKEMEVETAKLQRDIQLLN
QAMIQQEREAQVALKNEQQSHEEDLEKASQEKSTLRLALQAEKEELLHTGNLDKEDIMSK
YEAEKQELQEEIEAISQEHNEALIMAEAEKQQCLLIKETEKNALQEKLANAIQTIQELEN
EYEKQKRQANSKTEKDRATINQITQELKDFRTQFELATEAHEREIKGLNDACKQVHSMRD
AALKEVEDLKLQLRMAEDARDGVRRDLIEAQRKVRETEEARDRQRKENLELKRAINDESH
EKQTISKGNEQLRTQVKKAEQERISLKRSNEEKDQKIVVLDESRGNTQRENADLRASLRE
VERSRLEARRELQELRRQVKMLDSENTKKSKEVEDLQSRVSNDEEREEESRRESFGLKQK
IVATEASKEQALKENSMLQRKLAELEDDNRNKERDYLEQLGESHTSIKRQKDEIRNLVIK
TDELDEQLAENKLKLSASEGRVNGLENEIVKIEANKRDVEFKLGSLHSALRRTLGISRLG
RTMSPMRGRFDNTFTTTTDGKGTPIPSTGSPDRNRSFSPSFRRSASPTTEQLVQDIDPEV
VRAALRDFLQELKDTQREKDDTKIEVSNLTRQLMEMEADRDRVNQRLQQLQKSLGEAEEG
KRGAHGRLASAQTALMLQEETIRRNEREAKATAEKLAQLERTQQNSEVERRTLQDKINKM
KAQGAKCEAEKRKLKEAFEASEQRATKLELARRSLEGDYQRSKLSLTDKETSSQVQQERI
ANLSAQIQDLEGKCTSLQLTIDRLSNALAKTEEGESSLKDKVQSLSLSMSEKEAAATSLH
DKISQLQKMLTASEHDRRVLQERLQAARQTLTDLKKQNAALQERVQSSTHEMEDSEVRRS
ELENQSKSLQQMIAQHQEAEAGGLERIQKLQEEKRILQERITGLQRAIAQLDSEKRETQR
GAVRLEKDKTALQKTLDKVERERLKTEEESIKLADTKGLLNRSLRDMESEMDDARKTIQA
LQVQLADSEQTSAQRLIDVTSRHRQESELEMERLRTAQVQTERTLEARERAHRQRVKGLE
EQVATLKDQLTQEIRR
Download sequence
Identical sequences H2Z8C7
ENSCSAVP00000013839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]