SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33241990|ref|NP_876931.1| from Chlamydophila pneumoniae TW-183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33241990|ref|NP_876931.1|
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.97e-33
Family Ribosomal protein L6 0.0000558
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.45e-18
Family Ribosomal protein L6 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|33241990|ref|NP_876931.1|
Sequence length 183
Comment 50S ribosomal protein L6 [Chlamydophila pneumoniae TW-183]
Sequence
MSRKAREPILLPQGVEVSIQDDKIIVKGPKGSLTQKSVKEVEITLKDNSIFVHAAPHVVD
RPSCMQGLYWALISNMVQGVHLGFEKRLEMIGVGFRASVQGAFLDLSIGVSHPTKIPIPS
TLQVSVEKNTLISVKGLDKQLVGEFAASIRAKRPPEPYKGKGIRYENEYVRRKAGKAAKT
GKK
Download sequence
Identical sequences A0A0F7WGI5 Q9Z7S1
gi|15618543|ref|NP_224829.1| gi|16752407|ref|NP_444666.1| NP_224829.1.662 WP_010883271.1.15326 WP_010883271.1.24544 WP_010883271.1.35099 WP_010883271.1.46341 WP_010883271.1.48548 WP_010883271.1.81029 WP_010883271.1.8178 WP_010883271.1.91433 WP_010883271.1.95540 115711.CP0114 115713.CPn0633 138677.CPj0633 182082.CpB0659 gi|33241990|ref|NP_876931.1| gi|15836165|ref|NP_300689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]