SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62184858|ref|YP_219643.1| from Chlamydophila abortus S26/3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62184858|ref|YP_219643.1|
Domain Number 1 Region: 12-307
Classification Level Classification E-value
Superfamily SIS domain 2.45e-50
Family mono-SIS domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62184858|ref|YP_219643.1|
Sequence length 329
Comment hypothetical protein CAB215 [Chlamydophila abortus S26/3]
Sequence
MRSPTTSIDLCQDIVSKQRESLERFFGAFQCEDTWVLAEKILHHQGSIFFSGVGKSGCIA
RKIVATLQSFGEHALFLASGDLLHGDLGVVRPGDIVCLFSKSGETRELLECIPYLKERGV
FIAGITSATYSSLAVLCDHVVILPMIEELDPFNLVPTTSTTCQLLFGDLLAITLLRSRQI
SLADYGKNHPGGQIGLKVIGKIRDYMFLKTEVPFCSPEDTIADSLDIFSSYGCGCVCIVN
EKFEILGIFTDGDLRRALARHGGDILSQRLQDVMTPNPRVISEDADVLLGLQMMETGSPV
TILPVVDAKDQKYVVGLLQMHTLAKAGLI
Download sequence
Identical sequences A0A1X6V0B8 Q5L6P9
WP_011096905.1.109 WP_011096905.1.11364 WP_011096905.1.14083 WP_011096905.1.14344 WP_011096905.1.14517 WP_011096905.1.15032 WP_011096905.1.1879 WP_011096905.1.22818 WP_011096905.1.23093 WP_011096905.1.23350 WP_011096905.1.26184 WP_011096905.1.32323 WP_011096905.1.36616 WP_011096905.1.42032 WP_011096905.1.44888 WP_011096905.1.44963 WP_011096905.1.4586 WP_011096905.1.46162 WP_011096905.1.46624 WP_011096905.1.48359 WP_011096905.1.49966 WP_011096905.1.54567 WP_011096905.1.54594 WP_011096905.1.55182 WP_011096905.1.56716 WP_011096905.1.59503 WP_011096905.1.60858 WP_011096905.1.62355 WP_011096905.1.6521 WP_011096905.1.66261 WP_011096905.1.66406 WP_011096905.1.67892 WP_011096905.1.70375 WP_011096905.1.7272 WP_011096905.1.77225 WP_011096905.1.80513 WP_011096905.1.82153 WP_011096905.1.82677 WP_011096905.1.82922 WP_011096905.1.85140 WP_011096905.1.85143 WP_011096905.1.86343 WP_011096905.1.87259 WP_011096905.1.89149 WP_011096905.1.92051 WP_011096905.1.96891 WP_011096905.1.99375 WP_011096905.1.99796 gi|62184858|ref|YP_219643.1| 218497.CAB215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]