SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|527322836|ref|YP_008349033.1| from Chlamydia trachomatis J/6276tet1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|527322836|ref|YP_008349033.1|
Domain Number 1 Region: 3-346
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.02e-62
Family TK-like PP module 0.071
Further Details:      
 
Domain Number 2 Region: 317-476
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.75e-44
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.029
Further Details:      
 
Domain Number 3 Region: 494-627
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.44e-31
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|527322836|ref|YP_008349033.1|
Sequence length 640
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Chlamydia trachomatis J/6276tet1]
Sequence
MTYSLLPHIHSPQDLHALSLDKLPVLCDEIRNKIIESLSLTGGHLASNLGGVELTVALHY
VFSSPDDQFIFDVGHQSYVHKLLTGRNTEAFSNIRHDNGLSGFTTPQESNHDIFFSGHAG
NALSLALGLAKGSSNSSSHILPILGDAAFSCGLTLEALNNIPADLSKFIIVLNDNQMSIS
ENVGNIPQGISHWMYPQKISKLSQKIHSWIQNLPSFLHKKKTLSHKVDIALKSLSHPLFE
QFGLHYVGPIDGHNVKKLVQALQMIKDQPQPILFHVCTVKGNGLAEAERDPIRYHGVKAH
FQNTSLKKTSGNVELQTPISFPQHAGNILCRLGKKYPQLQVVTPAMSLGSCLEDFRKQFP
DRFTDVGIAEGHAVTFSAGIARSGTPVCCSIYSTFLHRAMDNVFHDVCMQELPVIFAIDR
AGLAFHDGRSHHGIYDLGFLCSMPNMVICQPRNALVLERLFFSSLLWKSPCAIRYPNIPA
NEKASNSFFPFSPILPGEAEILCQGDDLLLIALGHMCNTALTVKEHLLDYGISTTVVDPI
FIKPLDRKLLQSLLTHHSKVIILEEHSIHGGLGSEFLLFLNQHNIKADVLSLGVPDMFIP
HGNPETILNLIGLTSDHITQRILSHFKFSTPIPIERFFKA
Download sequence
Identical sequences A0A0E9DH58 O84335
gi|385244418|ref|YP_005812262.1| NP_219838.1.57406 WP_009871681.1.100644 WP_009871681.1.101362 WP_009871681.1.102133 WP_009871681.1.13674 WP_009871681.1.14984 WP_009871681.1.20093 WP_009871681.1.30792 WP_009871681.1.34934 WP_009871681.1.38504 WP_009871681.1.4264 WP_009871681.1.5036 WP_009871681.1.52091 WP_009871681.1.60427 WP_009871681.1.61004 WP_009871681.1.62239 WP_009871681.1.65391 WP_009871681.1.67250 WP_009871681.1.71619 WP_009871681.1.72034 WP_009871681.1.72442 WP_009871681.1.74323 WP_009871681.1.75470 WP_009871681.1.77651 WP_009871681.1.86066 WP_009871681.1.87079 WP_009871681.1.93216 gi|478460688|ref|YP_007735639.1| gi|478455263|ref|YP_007727453.1| 272561.CT331 gi|385240767|ref|YP_005808608.1| gi|527322836|ref|YP_008349033.1| gi|385243538|ref|YP_005811384.1| gi|478457072|ref|YP_007725665.1| gi|527328629|ref|YP_008354819.1| gi|527327704|ref|YP_008353895.1| gi|478475103|ref|YP_007724772.1| gi|527320028|ref|YP_008346228.1| gi|15605054|ref|NP_219838.1| gi|478459785|ref|YP_007733853.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]