SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|527322846|ref|YP_008349043.1| from Chlamydia trachomatis J/6276tet1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|527322846|ref|YP_008349043.1|
Domain Number 1 Region: 6-305
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.2e-69
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0000284
Further Details:      
 
Domain Number 2 Region: 325-528
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.58e-64
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000436
Further Details:      
 
Domain Number 3 Region: 512-644
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.62e-37
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|527322846|ref|YP_008349043.1|
Sequence length 650
Comment 2-oxoisovalerate dehydrogenase alpha subunit [Chlamydia trachomatis J/6276tet1]
Sequence
MLLLSRQSGSGGSFQLSCAGHELAGVVAAKSLIPGKDWAFPYYRDQGFPLGLGCDLSEIF
ASFLARTTQNHSAGRMMPYHYSHKKLRICCQSSVVGTQFLQAAGRAWGVKNSGKSEVVYV
SGGDGSTSQGEFHEMLNFASLHQLPLVIAIQNNQWAISVPFADQCGADLVALGNSYSGLA
TYEVDGGDVSALTQTFERAVSDARHRHIPALVIVNVVRLESHSNSDNQAKYRSEEDLSCC
QAQDPLVRLEKSLLDDFGVAHEVIEQIKAELQETVNQACELAESAPFPCKGATKHEVFAP
YNISLIDYENALETASLQKLEPRVMRDAITEALVEEMQRDPGVVVFGEDVAGNKGGVFGV
TRTLTEQFGENRCFNTPLAEATIIGAAVGMAFDGFYKPVAEIQFADYIWPGINQLFSEAA
SIYYRSAGEWEMPIVIRTPCGGYIQGGPYHSQNIEAFLAHCPGLKVVYPSNAADAKALLK
AAIRDPNPVVFLEHKALYQRRLFSTTPVFSSDYVLPFGQARIVHPGTDLTIVSWGMSLVM
SVEVARDLLELGISVEVIDLRTIVPCDFATVCESVKKTGKLLVVHEASEFCGFGSELVAL
VAERAYRYLDAPIKRIGALHAPVPYSKVLENEVLPQKEKIFQEAKLLAEF
Download sequence
Identical sequences gi|527322846|ref|YP_008349043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]