SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78188033|ref|YP_378371.1| from Chlorobium chlorochromatii CaD3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78188033|ref|YP_378371.1|
Domain Number 1 Region: 245-579
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.3e-89
Family beta-Lactamase/D-ala carboxypeptidase 0.0000532
Further Details:      
 
Domain Number 2 Region: 49-244
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 4.84e-30
Family Penicillin binding protein dimerisation domain 0.0016
Further Details:      
 
Domain Number 3 Region: 606-662
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000209
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78188033|ref|YP_378371.1|
Sequence length 663
Comment penicillin-binding protein 3 [Chlorobium chlorochromatii CaD3]
Sequence
MTNPEFRNRLGIVIGGFAVFIIIIIAMLLNIQVINVEKYKKKAERQYVKQVTEYARRGAI
LDRRSRVLAESVESITFYASPKQISKSLLFDEEGEAVINKRNNKQQTFDNTQGVATLFAK
HLGANRQIYLKALKKRKGVAVLAKKVPIEKALPLITEIKSRKMHGIWHEKEQQRSYLNVA
AQLIGMTGNEKSSVDGGSGLELQLNKELKGVNGKRYYQRHATGELYTAPDVAQKAPKSGN
SVQLTIDSDIQSIVEDELSKAVAEFQADAATGVVMDVRTGEILAMASSPTFDLNRRSTWT
QDNSRNRAVTEMFEPGSTFKLVMAAAATEVLHRKSSDYVYAHNGVMPYYKLKIRDHEPYG
TITFKEALMHSSNIVAATTAMKLGRETFYAYTKNFGFGQKTGVGLVGEARGIVRPLEKWD
STTLPWMGYGYQVMVTPLQILQAYATVANDGELMRPYIIKKVVSPEGKVIRETAPEVVRR
VLKPETARYVSREYFKAIVDSGTAKNPILQSLHAAGKTGTARRASAGSYAVRSYVSSFVG
YFPVSSPRYAMIILVETPRTSYYAAAVAVPVFARIASRMVACSQEMQKMLAIRSPEQELI
DSLATVTVPDLRGLKGREAQRMLSWLGLTMEHSGDFNGVVVSQSVSSGTQVAKAKTVVVR
LSK
Download sequence
Identical sequences Q3ANV9
340177.Cag_0049 gi|78188033|ref|YP_378371.1| WP_011361103.1.38767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]