SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78188677|ref|YP_379015.1| from Chlorobium chlorochromatii CaD3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78188677|ref|YP_379015.1|
Domain Number 1 Region: 133-191
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000366
Family Multidrug-binding domain of transcription activator BmrR 0.08
Further Details:      
 
Weak hits

Sequence:  gi|78188677|ref|YP_379015.1|
Domain Number - Region: 62-94
Classification Level Classification E-value
Superfamily Lysozyme-like 0.054
Family C-type lysozyme 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78188677|ref|YP_379015.1|
Sequence length 203
Comment hypothetical protein Cag_0701 [Chlorobium chlorochromatii CaD3]
Sequence
MEKRDLKKELRHLYNPSPKAVEMVDVPTMNFLMVDGMGDPNTSQTYADAIEALFSLSYTI
KFMVKKGEMALDYGVMPLESLWWCEDMSTFSPDDKSNWQWRAMIMQPSWITEDLVNQAIE
EVKRKKGLAALPFVRFEAFEEGVAAQIMHIGHFAEEAPTIEKLHHFIAANQKQRRGKHHE
IYLSDIRKAKPEAWKTIIRQPLA
Download sequence
Identical sequences Q3ASQ3
WP_011361744.1.38767 340177.Cag_0701 gi|78188677|ref|YP_379015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]