SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78189075|ref|YP_379413.1| from Chlorobium chlorochromatii CaD3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78189075|ref|YP_379413.1|
Domain Number 1 Region: 3-287
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.1e-95
Family Methylenetetrahydrofolate reductase 0.000000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78189075|ref|YP_379413.1|
Sequence length 289
Comment 5,10-methylenetetrahydrofolate reductase [Chlorobium chlorochromatii CaD3]
Sequence
MLVKEILSAANNPVFSFEFFPPKKDEEWDTLFKTIAALSPLHPSYVSVTYGAGGSTRSRT
HNLVTRIQQETGLTVVSHLTCISSEESDTEAILRNYQENGINNVLALRGDKPTGVATLQE
AIKDFPHAIDLVRFIKRNFPDFGVGVAGFPEGHPETPNRMQEIEYLKAKVDAGADYIVTQ
LFFDNRDYFDFVERCQLAGITVPVIPGIMPIATKKGMIRMSELALGSRIPAPLIKQVLAA
ENDSDVAAIGIEWATAQVQELINQHIRGIHFYTLNMADATLKIFRNLSA
Download sequence
Identical sequences Q3ARK5
WP_011362134.1.38767 340177.Cag_1108 gi|78189075|ref|YP_379413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]