SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89897922|ref|YP_515032.1| from Chlamydophila felis Fe/C-56

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89897922|ref|YP_515032.1|
Domain Number 1 Region: 353-372,436-653
Classification Level Classification E-value
Superfamily HAD-like 1.5e-50
Family Meta-cation ATPase, catalytic domain P 0.0015
Further Details:      
 
Domain Number 2 Region: 157-250
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.57e-20
Family Calcium ATPase, transduction domain A 0.0085
Further Details:      
 
Domain Number 3 Region: 101-153,251-344
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000471
Family Calcium ATPase, transmembrane domain M 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|89897922|ref|YP_515032.1|
Sequence length 657
Comment cadmium/zinc cation transporting ATPase [Chlamydophila felis Fe/C-56]
Sequence
MFSQLFSTPFSPEVLNDFFESGMTEDNSPMLSRKNRLLSRNLSLKSACLSLGTYLGALAF
YWLHIVDVSNLFVIFTFFLAGTPALIKSLDDIRNKTVNIDILMTSAAFGSIFIGGALEGS
LLLVLFAISEALGQMVSGKAKSTLASLKHLAPTIAWVVGEDGNLEKTPINQVLVGNIIRV
KSGEIVPLDGEIIHGSSSINLMHLTGEKIPKSCQVGSIIPAGAHNLEGSFDLKVLKTGAD
STIAHIINLVIQAQKSKPRLQQRLDKYSSAYALTIFAISIAIAILVPLFTSIPFLGPNSA
FYRALAFLISASPCALIIAIPIAYLSSINACAKHGVLLKGGVVLDRLASCDSIVMDKTGT
LTTGELTCIGCDNFGPENPDFFPSILALEQSSMHPIAQAIVIYLIKNNVSSRPAEEYCVI
PGKGVRGIFQGQEAFVGKIDTALQKIPGEYVQEIEDRVHTARQRGEICSLAYLQGHCALF
YFKDTPRPDAGKIIKELKDEGYSISMLTGDHQVSAENTAKLLGISEVFSNLSPDDKLEKV
RELANQRHIVMVGDGINDAPALAQATVGVAMGEAGSATAVEAADIVLLHDAISLLPWIIK
KAKKTRRIVTQNLGLALAIILLVSWPASLGIIPLWLAVILHEGSTIIVGLNALRLLK
Download sequence
Identical sequences Q256A1
264202.CF0115 gi|89897922|ref|YP_515032.1| WP_011457672.1.63481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]