SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568302302|ref|YP_008974587.1| from Phaeobacter gallaeciensis DSM 26640

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568302302|ref|YP_008974587.1|
Domain Number 1 Region: 850-978
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.75e-25
Family Aromatic dioxygenase reductase-like 0.0021
Further Details:      
 
Domain Number 2 Region: 756-852
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.42e-20
Family Ferredoxin reductase FAD-binding domain-like 0.0012
Further Details:      
 
Domain Number 3 Region: 963-1069
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.85e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0066
Further Details:      
 
Domain Number 4 Region: 547-625
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000733
Family Short-chain ferredoxins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568302302|ref|YP_008974587.1|
Sequence length 1071
Comment Flavodoxin reductase (ferredoxin-NADPH reductase) family 1 [Phaeobacter gallaeciensis DSM 26640]
Sequence
MSLRLFSTRSRPIHMGPFPMERVQPGPMPDLRGVPPFQPLNFRRPDMPASIVNAMGEYQA
MMDAIRDGLVNKAQADCPSDPQERADHIKAFGYFSDAAMVGIGPMPASARLDVPYRNPDI
DRLSHDLKTRQTKTLASGIDMIMADLRDAMKAPPTTIGDHTHSVVFLYDMPRDPRPDEAG
CDWLDGAERHRACLRASETAVVLANYIRLLGWDAKAHTGSSADVDLNQLTVAAGLATVED
GKLVNPYLGTRFGVAVVTTDFEMARDKPLLPQELQPVMQVKGPKWWLGVGSERSALNGDP
FARRDFCDGPHPFETLKRVADPTTYIDEARVARVPKRADMFARSQFGDMGKTNQAAATGG
FYVRKAAPSMAQRRMLGAFVLLQDGAPAPQAPRPTDAERNAANIKAASYWLGIDAVGISR
CPEWTWYSHDATGAEIHPEHDQAISMIVDQGFDTTEGTSGDDWIAVAQSMRAYLRFSLLG
GVIARQIRNLGYKAKAHTVMDGEVLQPPLLLLSGLGEVSRIGEVILNPFLGPRLKSGVVT
TDMPMAHDKPIDFGLQAFCEACNKCARECPSGAITAGPKLMFNGYEIWKSDSQKCTTYRI
TTPGGAMCGRCMKTCPWNLEGIFKEKPFRWAAMNMPAVAPALAKLDDMVGNGEMNPAKKW
WWDLELEEDGGYRPTRHPVNARALQKDLDLRYEDQTLAVYPAHLAPHPWPYPFPMDREAG
IEAYQAMVTAEEYKARRARGETGGWDHIYTNDGDSPVLRVEVSNVEEMSSGVTKYEFRSL
DGSPLPEWTAGAHLDIVVAPEFLRQYSMSGDPADRSKYQIGVLREDLGRGGSKLLHRIFT
KGRRVFISKPINHFPLVEEARRSFLMGGGIGVTPMIAMAHRLHALGQPFELHYSVSSRQD
AGYLSDLAAMPWAEHVHIHVSDEGSRANLDRVLADYQDGWHVYTCGPDRYMGGVMEAAER
QGFPEEARHLEYFSVPEVPEYENHDFTLKLSRSGRELLVPAEKTATDVLAENGIHIDVKC
SDGICGVCKCGLIAGEVEHRDFVLSKAQRQDAVILCQSRAAEKDGVIEVDL
Download sequence
Identical sequences V9WGY8
WP_024096063.1.25178 WP_024096063.1.95089 gi|568302302|ref|YP_008974587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]