SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568304776|ref|YP_008977061.1| from Phaeobacter gallaeciensis DSM 26640

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568304776|ref|YP_008977061.1|
Domain Number 1 Region: 94-242
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.96e-32
Family Reductases 0.019
Further Details:      
 
Domain Number 2 Region: 236-355
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.08e-29
Family 2Fe-2S ferredoxin-related 0.0083
Further Details:      
 
Domain Number 3 Region: 3-105
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.51e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568304776|ref|YP_008977061.1|
Sequence length 357
Comment Flavodoxin reductase (ferredoxin-NADPH reductase) family 1 [Phaeobacter gallaeciensis DSM 26640]
Sequence
MARFHDLEVTDVRKTIRDAVVVTLKPAGGAAEEFNFTQGQYLTFRRDFDGEELRRSYSIC
AGRGEGILQVGIKRVDGGAFSTWANTELKAGDTLQAMPPMGSFFTPLNGAAEKHYLGFAG
GSGITPVLSILKTTLDAEPNSSFTLVYANKGVNTIMFREELEDLKNLYMGRFNVIHVLES
DAQEIDLFTGLVTEEKCAQLFEHWIDIQSVGTAFICGPEPMMLGIASALRTAGLDDSQIK
FELFASAQPGRAKRTATASDAASGANQTKAAITLDGATQTIEMGKNMTLLDAALENAMDA
PYACKAGVCSTCRCKVLEGEVEMVANHALEDYEVEKGYVLSCQAYPLSDKVVVDYDQ
Download sequence
Identical sequences V9WIH2
WP_024098443.1.25178 WP_024098443.1.95089 gi|568304776|ref|YP_008977061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]