SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338529793|ref|YP_004663127.1| from Myxococcus fulvus HW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338529793|ref|YP_004663127.1|
Domain Number 1 Region: 282-516,585-624
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.03e-57
Family Type II chitinase 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|338529793|ref|YP_004663127.1|
Domain Number - Region: 198-280
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000597
Family I set domains 0.061
Further Details:      
 
Domain Number - Region: 508-560
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00445
Family Chitinase insertion domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338529793|ref|YP_004663127.1|
Sequence length 626
Comment putative chitinase [Myxococcus fulvus HW-1]
Sequence
MVLATGGSAAWAAQAEARPPAAAVDTAEGAAPEFVPTTTSWIYREAMEAPWQDYSWAPHS
LTNTSPVAAGRHSISVTMRAWEALYFNTSPLTVAPGMTLTLSVHGGASGNNAVVQTRAVV
NGAFTPGTELGPYCTGGRIRANTWSTCTIPISVLAPQGARFTGLALQEGRGLSLPTLYFD
ELGVRGIPAPAPQVEVAINPTSATVPAGGTQAFTATVTGSANTAVTWSVQEGASGGSVTA
AGLYTAPSSAGTYHVVATSQAAPTKSAVATVTVTSTPPPPGGKWVSGYYTGWNADLYPPE
KVDFTALTHILVGRVTPNPDGTVNTQFDNSNGPAIARTLSTRAHAAGRKAIIMVGGAGEH
DGWVGAASSANRARFVQNLVNAMETFGYDGLDIDWEPVEQADKPALLALIQELRAARPQM
LLTMPIGWVNSNFPEDADPWFTHLVPYLDQMNVMSYEMTGPWGGWLSWYTSALRGESGYH
PTSVSSSLNAWVGAGIPRSKLGMGIPFYGMAWRNITGPYQPYTDWSDYVGSDNSFTYEKI
LELSATGVYRWDEAAQASYVTFDVPVEDGTVRWISYDSPQAIAAKGAFAHDNGFGGTIIW
TINQGCTDPATGANPLLDAVKDAFLE
Download sequence
Identical sequences F8C8K3
gi|338529793|ref|YP_004663127.1| WP_013935225.1.19289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]