SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338530165|ref|YP_004663499.1| from Myxococcus fulvus HW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338530165|ref|YP_004663499.1|
Domain Number 1 Region: 371-606,675-714
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.31e-60
Family Type II chitinase 0.00093
Further Details:      
 
Domain Number 2 Region: 191-280
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000254
Family Fibronectin type III 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|338530165|ref|YP_004663499.1|
Domain Number - Region: 287-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000634
Family I set domains 0.065
Further Details:      
 
Domain Number - Region: 598-651
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0732
Family Chitinase insertion domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338530165|ref|YP_004663499.1|
Sequence length 716
Comment putative chitinase [Myxococcus fulvus HW-1]
Sequence
MLAVGVQLSACGTESIADAQLPEAPAIEDTPAVQAEAVDDGATTLYEDALGPGWADWSWA
TRNLAAASPVASGSRAISVTFGPWTGLYLHHSGVSTSGLEFLEFQVHGGATSNPALTTYA
TVGNQARPTIAINRYCDGGAIKAGAWTRCRVPLTALNVANVTMDGIAIQEGAGRNLPVMT
FDSLRLGTATLSAPSGLKAGASATDVSLTWNGVSGATGYHVYRATSQTGTYAKRTTTPLT
NTTYRDINVSAGATYWYAVTAVGTGGEGLRSTPVSATVQPPQQQVAISVTPTSASLAPGA
SRTFTAAVTGSTNTAVTWSIQQGGAGGTITHAGQYTAPRTTGTYHVIATSQADTTKKATA
TVSVAATQPGSGKWVSGYYTGWNADLYPPEKVDFSALTHIIVGRVTPRPDGTLNTAFDNN
NGPQIARTLAQRAHAAGRKAIIMVGGAGEHAGWVSAASNANRARFVQNLLNAMDTFGYDG
LDIDWEPVEAADKPNLLALVKELRAARPDMLLTFPIGWINSNFASDADPWFANLAPYLDQ
INIMSYEMIGPWDGWQSWYTSALYGESGNRPTSVSSSLQGWARAGIPKAKLGMGIPFYGM
AWRNITGPYQDFTHWSDYVGSDNAFTYQKIQQLSAAGTYRWDAVAAASYVTFNTPVEDGT
VRWISYDSPQAIAAKGAYAKDHGFGGTIIWTINQGCTNPTTGANPLLDAVKGAFLQ
Download sequence
Identical sequences F8CFB3
gi|338530165|ref|YP_004663499.1| WP_013935593.1.19289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]