SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338532105|ref|YP_004665439.1| from Myxococcus fulvus HW-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|338532105|ref|YP_004665439.1|
Domain Number - Region: 33-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0002
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338532105|ref|YP_004665439.1|
Sequence length 211
Comment putative lipoprotein [Myxococcus fulvus HW-1]
Sequence
MRPTLRVLLLAACAAAAAACGGDEDPKPVEQGDPCEPNGHIHREPTGDWCHCNKGYVAAE
DGLACVPDPDYVPSEGFDFGDDGEHACWHVTNGPFVTVNATTARHPRVDDFHTYYTVKLL
PENGQYVGTFSYKAFTTGNFVVYLSSPAVPVTLTETAVSTTVPQAGAQATGGYCDALKHM
VGYELTDRVQYTLQLGPTSLPELNMVIEHVE
Download sequence
Identical sequences F8C6H3
WP_013937522.1.19289 gi|338532105|ref|YP_004665439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]