SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338534120|ref|YP_004667454.1| from Myxococcus fulvus HW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338534120|ref|YP_004667454.1|
Domain Number 1 Region: 201-481,558-589
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.12e-96
Family Type II chitinase 0.000000928
Further Details:      
 
Domain Number 2 Region: 43-85
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.0000000000000235
Family Carbohydrate binding domain 0.00069
Further Details:      
 
Domain Number 3 Region: 481-557
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000000623
Family Chitinase insertion domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338534120|ref|YP_004667454.1|
Sequence length 599
Comment glucosyl hydrolase family protein [Myxococcus fulvus HW-1]
Sequence
MRRSWWASGLIATALSVVGCDSEGPSFPTGDLTAFQEAALASEWAVGVTYAVGTRVTYQG
RLYECRQPHTSQADWTPAAVPALWLDLGPASGGEPDGGSGGTDAGTGGDVTAPTVGLNAS
NSRITAAGSLSVTATATDDVGVTRVELLENGAVVATGTQFSRAFTGWEQNGTYVYGVRAY
DAAGNVGTATLTVVVEIPGGPPPTGKRIVGYFTAWGIYARNYQVSNVQPAKLTHINYAFS
NISPDGRCILGDPYADIDKGGGWQGEWDPGALRGNFRAFKELKRQHPHLKLLISVGGWSW
STHFSTVASSPASRAAFVKSCVDLYIRGQYPGVTPANGEGVFDGIDIDWEYPVGGGLPGN
SNSPADKQNYTLLMQEFRSQLNAVTAQTGKPYLLTIATGASPDLLENKQETKKLSDVLDW
INVMSYDYHGAFEPTTNFHSALNRVTGDPGASAGFYTEGSVSKMLQLGVPPAKIVVGVPF
YGRGWGQVPNVNNGLFQPGIPIMGTWDDGTSGPTGVFDFKDIKNRFERAGSGYTKFFHPE
AKQAYVFNPSTGVWIGYDDVQSITAKSDYILNNNLGGAMFWELSGDDGSLLDELARKLR
Download sequence
Identical sequences F8CK00
gi|338534120|ref|YP_004667454.1| WP_013939506.1.19289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]