SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338536148|ref|YP_004669482.1| from Myxococcus fulvus HW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338536148|ref|YP_004669482.1|
Domain Number 1 Region: 231-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000262
Family EGF-type module 0.057
Further Details:      
 
Weak hits

Sequence:  gi|338536148|ref|YP_004669482.1|
Domain Number - Region: 278-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0967
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338536148|ref|YP_004669482.1|
Sequence length 348
Comment EGF domain-containing protein [Myxococcus fulvus HW-1]
Sequence
MKVIRVAPMRRWLSAVLVFGMLGACGPELEQESLGSEAALVEGEQSPDAVSAMGGDRYAN
AVVQGGVVAVLNPNNAVGAPDGNVATFVGLLGGALVLDMGKGEEGTGPLRIYYQGLSLAV
IAKVEFLRADMSIISTGQANLLDLGLGTHSALVPFSSTTPYRYVRLRSGVASLYSLDAVE
ATGSGAGATCGDGRVSHGEQCDDGNRAQGDGCGSTCQVEPGFSCQGTQPSICQDINECAN
GTAQCSVNAVCTNTPGSYVCTCRPGYSGNGFTCTDIDECANGTDTCLPGQQCVNTPGGFE
CTGGACTPPQVQCGAQCVNVSSDPNNCGACGVVCPVSKHCWEGTCVLP
Download sequence
Identical sequences F8CB23
gi|338536148|ref|YP_004669482.1| WP_013941492.1.19289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]