SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338534179|ref|YP_004667513.1| from Myxococcus fulvus HW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338534179|ref|YP_004667513.1|
Domain Number 1 Region: 854-1096
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000000981
Family Tropomyosin 0.0082
Further Details:      
 
Domain Number 2 Region: 701-914
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000159
Family Tropomyosin 0.006
Further Details:      
 
Domain Number 3 Region: 2-99
Classification Level Classification E-value
Superfamily CheY-like 0.0000000166
Family CheY-related 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|338534179|ref|YP_004667513.1|
Domain Number - Region: 576-678
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.000915
Family PspA lactotransferrin-binding region 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338534179|ref|YP_004667513.1|
Sequence length 1629
Comment adventurous gliding motility protein AglZ [Myxococcus fulvus HW-1]
Sequence
MATVLKGAGYQTNLAETSADAQRELEKRRPDLVVLRAELKDQSGFVLCGNIKKGKWGQNL
KVLLISSESGVEGLAQHRQTPQAADGYLAFPFELGDLTALSHGIVPPGTDDTSASLDAAL
NGTREAPPPMPPSLKAAGGPPKLPKRERRSAMTEEDRAFLDRTFQSIAERKAELLAESRQ
LKRPPPRRELMGTPEGKIQILRDELKTREAQLARLSEIWSVRERELLSGEDRIHEKDVEL
QGLKMQVDDLLRRFNEAQQATIQKEREHGATVDDLLLQKFSAEKDLIEVVASKEKDINLL
RREVSRAEEELARRASELEHGRNEYDKLEKHLGVVTLEFEVKEQKLQDTVLANEGEIARL
TRRGDDFEAELGRTISERDQRFAELDGEIQALQERLQQTEQERDTTVRGLEARAARAEEH
GTQADAEIHRLNAERDALEAKLSQQVADLETDLARTTGERDQLRLDKDAQEAELTRRVEE
RDAKLGTLERELSETIARNEHTEAELNANIQQHLERIGELEGEVEAVKAHLDDRENELTA
ELQALGQAKDELETDLNDRLQALSQAKAELEADLTGQIQALTSQLEETQRQLDDSQRTGE
QLSARVAMLEDTVAQRDGTIEALQGDVAARDQRISELSGDLEATSQTLTQTQQTLAQTEQ
QLADTQNTLASTEGTLAQTRGELDATSQTLTQTQQTLAQTEQQLADTQNTLAETRGELDA
TSQTLAQTQQTLAQTEQQLADTQNTLASTEGTLAETRGELDATSQTLTQTQQQLASTEGA
LAETRGELDATRQTLAQTQQTLAQTEDSLAQTRGELDATTQTLTQTQQTLAQTEQQLADT
QNTLASTEGTLAQTRGELDATSQTLTQTQQTLASTEGALAETRGELDATSQTLAQTQQTL
AQTEQQLADTQNTLASTEGTLAQTRGELDATSQTLTQTQQQLASTEGALAETRGELDATK
QTLAQTQQTLAQTEDSLAQTRGELDATTQTLGQTQQTLAQTEQQLADTQNTLASTEGTLA
ETRGELDATSQTLADTQARLSGTEGALAQTRDTLAHTTHERDQRIAELADLGAAKDALEQ
ELTGQIGQLRSELSETQGNYEAERAAHEKLAAESSAHIGDLTSERDGLRAELEATSQTLE
QTQGQLAATRDALAKEQHAHQESRKAAANTQAALEGQLAEARAHGEDLGEHLTLTKHELG
TRVAEVTQLTATLAQAENARATLEERLHTLTEESQRREELLQNDLTQKGTELSDTLRKLT
HVTQEKMRQAEVLNREVATRTEQLKAMEARLQAQATEARRQAEGLGQQVAGLNEQLEQGR
KALAGREDQLRAAGTAQQKLTAERDGLAGQLQQAEARLQQQAQQATQERADAKRAADELA
AKLAKAEQRVAQLTQDAQTQAAEHDARAKELQGQLTARAKKIQDLELAVENAHGTKARAE
KELNAKVAAAEARAHEATTRLAAAQKERKDLEARHAKEQEELTAKQKAELERRDSIKAQE
VARLQQSVQEKSKALKVAELELARYKSKSTAAASKAAAARPAEDDDLAVRTQLNQVIPPA
AAPAAPAKKAAARPAAQAAAKKAPAPAPAPAPPAALSDESEPTDRTLVIQLPTAKEDDDW
TALVDELDK
Download sequence
Identical sequences F8CK59
gi|338534179|ref|YP_004667513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]