SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78044312|ref|YP_361101.1| from Carboxydothermus hydrogenoformans Z-2901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78044312|ref|YP_361101.1|
Domain Number 1 Region: 80-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-27
Family Translational machinery components 0.00014
Further Details:      
 
Domain Number 2 Region: 8-76
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.49e-24
Family Ribosomal S5 protein, N-terminal domain 0.0000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78044312|ref|YP_361101.1|
Sequence length 167
Comment 30S ribosomal protein S5 [Carboxydothermus hydrogenoformans Z-2901]
Sequence
MARIDASQLELSEKVIAINRTAKVVKGGRRFSFSALVVVGDQKGHVGVGLGKAPEVPDAI
RKGIEDAKKNLIKVPIVNTTIPHEIIGEAGAGKVLLKPAAPGTGVIAGSAVRAILEMAGV
RDILTKSLGSNNPHNMAHATIEALKSLKTVEMVAKLRGKTPAEILKG
Download sequence
Identical sequences A0A1L8D0M9 Q3A9T3
246194.CHY_2292 gi|78044312|ref|YP_361101.1| WP_011345174.1.36915 WP_011345174.1.88130 WP_011345174.1.931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]