SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|304313851|ref|YP_003848998.1| from Methanothermobacter marburgensis str. Marburg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304313851|ref|YP_003848998.1|
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.85e-60
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00089
Further Details:      
 
Domain Number 2 Region: 277-464
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.83e-34
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|304313851|ref|YP_003848998.1|
Sequence length 466
Comment esterase [Methanothermobacter marburgensis str. Marburg]
Sequence
MNDTHGYLKSHPELFWEGRNIRYETLGGYHHIAGLVDGIREEGPTLLFDCGDTIHGTYHA
VKSEGAALIPILNEMRFDAMTAHWEFAYGPRRFMEISEKLNHPVLAINCYHEGTERLAFR
PYEIVERGDLQVGVVGIASNIVDKVMPPRFSEGLEFTLGRDELPYWIEVLRDEERVDLVV
VISHLGFPQECQLAADVDGIDVLLSAHTHNRLERPFIVNDTIIIQSGCHGSFIGRLDLEV
DGGVQKFKHELVRVRGPSNEDVEEMVMRAVEVDRDYLEATVGSTRTHLNRYTILESTMDN
LLLRAIMDADDSELAFSNGWRYGAPVPPGDIRVEDLWNIIPVNPPVSRVELLGREILEMM
EENIELTFSRDPYRQMGGYLKRCMGLEIYFKIENPPGSRVQKIFVNGKPLEPDRTYSAVY
VTSQGVPSRYGDNHEEMDIRAVDALREYVEKNSPVDAELDGRITPV
Download sequence
Identical sequences D9PTY7
WP_013294914.1.93414 gi|304313851|ref|YP_003848998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]