SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|304314957|ref|YP_003850104.1| from Methanothermobacter marburgensis str. Marburg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304314957|ref|YP_003850104.1|
Domain Number 1 Region: 5-154
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.5e-18
Family GHMP Kinase, N-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 229-277
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000000403
Family Galactokinase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|304314957|ref|YP_003850104.1|
Sequence length 286
Comment shikimate kinase [Methanothermobacter marburgensis str. Marburg]
Sequence
MRKAVRAPGSATVINAIATGRGSAFGIGLSVRAEAELIDSGIECISLEGADTALIELCTE
MVLEHYGADTGVRVVTASDLPVASGLSSSSAASNATVMAVSELISEEFQLEPMDGSEMLN
MAVDASLRAGVTVTGAYDDASASFYGGLTVTDNMARRIICRREMENQKVLIYMPDRKSLT
AQSDVPRMKLLAPWVDMAFREVLEGRVHSALTLNGILYCASLGFDPGIALDALEAGALSA
GLSGTGPAFVALADEDSAGKVIDSWENLEGNVTVTSVDNQGTHVLD
Download sequence
Identical sequences D9PX43
WP_013296013.1.93414 gi|304314957|ref|YP_003850104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]