SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|304314982|ref|YP_003850129.1| from Methanothermobacter marburgensis str. Marburg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304314982|ref|YP_003850129.1|
Domain Number 1 Region: 2-150
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.16e-16
Family GHMP Kinase, N-terminal domain 0.0039
Further Details:      
 
Domain Number 2 Region: 244-295
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000448
Family Galactokinase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|304314982|ref|YP_003850129.1|
Sequence length 326
Comment phosphomevalonate kinase [Methanothermobacter marburgensis str. Marburg]
Sequence
MIINTPSRLHLTLIDLNGRRGRLDGGVGITLREPELIMGLEASDEITVEFTGEVDSSLRE
EYVSKITAAAERTLSYIGSDEKFAFKVESMFPAHSGLGSGTQISLAAAKLIAEYHGASIR
ARELAAIVGRGGTSGIGVASFEKGGFIVDAGHNTREKSDFLPSSASHASPPPVIARYDFP
EGWNIVVAIPHIERSVSGKKEVNIFQEYCPIPLREVERLSHIILMKMMPSVIEGDIEAFG
ESVNEIQKIGFKKVERDLQDPLIDRLIDAMLSAGAAGAGMSSFGPAVYAVTDGKADDMVD
AVLEIMDSGQAFVTGGRNRGASVIRS
Download sequence
Identical sequences D9PX68
WP_013296038.1.93414 gi|304314982|ref|YP_003850129.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]