SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|304314993|ref|YP_003850140.1| from Methanothermobacter marburgensis str. Marburg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304314993|ref|YP_003850140.1|
Domain Number 1 Region: 61-193
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.14e-27
Family MJ1460-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|304314993|ref|YP_003850140.1|
Sequence length 196
Comment hypothetical protein MTBMA_c12390 [Methanothermobacter marburgensis str. Marburg]
Sequence
MSGLRALIREYRKITDNEIKSETGNGTLMGPRGPLKESIEFRDLLNPSRRYFSAFKEDDK
YVSSFRLGHFNIPDIIAGSAAGVSYIGGMNLGRALIKEGLADDTRSLGELMLEHKLGILD
VISEEGNGRHLTMDIRVYECIECSGLPNIGRPICFFEAGIIAGALSEILGGRVDAYERRC
WTNGYSFCQFDVRARI
Download sequence
Identical sequences D9PX79
WP_013296049.1.93414 gi|304314993|ref|YP_003850140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]