SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|304315473|ref|YP_003850620.1| from Methanothermobacter marburgensis str. Marburg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304315473|ref|YP_003850620.1|
Domain Number 1 Region: 117-248
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.62e-30
Family MJ1460-like 0.026
Further Details:      
 
Domain Number 2 Region: 12-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000307
Family MarR-like transcriptional regulators 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|304315473|ref|YP_003850620.1|
Sequence length 249
Comment transcriptional regulator [Methanothermobacter marburgensis str. Marburg]
Sequence
MRERQQFTIFATDRGIEVIESPVKSLILSELIKRELRFQDIVRITGKSKSTVSKHLSDLR
MAGLIVERPDPADRRIKVFSINSRYLGKLRRKKRGELDEEKTEFLAKHLTSVGDPFEFFR
LMFHVLRVELIKEGINIDPILHEAGLKIGEVIYPSLGAGNLEDLLENLRRFWRINRLGTL
KVESTDPLIIRAYDCFECGLLPDIGESACALDLGILEAVFGRYFNSDVEIQETECYARGD
ERCSFLINP
Download sequence
Identical sequences D9PYK9
gi|304315473|ref|YP_003850620.1| WP_013296517.1.93414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]