SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296124289|ref|YP_003632067.1| from Planctomyces limnophilus DSM 3776

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296124289|ref|YP_003632067.1|
Domain Number 1 Region: 286-583
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.58e-89
Family DNA repair protein MutS, domain III 0.000000805
Further Details:      
 
Domain Number 2 Region: 587-819
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.07e-64
Family ABC transporter ATPase domain-like 0.000000751
Further Details:      
 
Domain Number 3 Region: 8-122
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.15e-43
Family DNA repair protein MutS, domain I 0.0000168
Further Details:      
 
Domain Number 4 Region: 121-285
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 3.92e-38
Family DNA repair protein MutS, domain II 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296124289|ref|YP_003632067.1|
Sequence length 891
Comment DNA mismatch repair protein MutS [Planctomyces limnophilus DSM 3776]
Sequence
MPADPPFPVDRAGLTPMMQRYLEVKDQHPAAILFFRMGDFYELFYEDAKVAARILGLTLT
SRDKNSENPVPMAGFPYHALTGYLQKMIRAGHRVAICEQVEDPKAAKGMVKREVTQIVTP
GTLTDDSLLDPRETNLLAAILPGKSHSGLAWLELSTGRFICATLPASQIHDELARLQPAE
VLTPERSREDLTIARIRLGAWAVTERPPWAYRPEEAHRLLLDQFGVATLEGFGFSGNSSS
TTQATIEPGIIAAGALLEYVRETQKSQLIHLSRLEPYEPSQHLLIDESTRRSLELTRTLR
SNQREGSLLWAIDQTVTPMGARLLLEWLSNPLKERTAIEARLNAVSELVVDLRTTQSLQE
ILKTGYDIQRLTARIGTGRATPRDLVSLTRTLSLLPQIKARLAGRRSTLLNELEAKIDLH
QDLREAIEAALVDEPPLNLTEGGAIRPGFDPQLDEWRDLARGGKEWMAAYQAEEVRRTGI
ANLKVGFNRVFGFYLECSASQADKVPPEYIRKQTLKNYERYITPALKEYEDKVLQAESRS
IALEQQLFSDLRQKVSSRAAELRVTAESLAVLDVLCSFAILATRRQYVRPEIASEPVLEI
RQGRHPVLDQLLPTGGFVPNDIRLGGSNGLIQLITGPNMAGKSTYIRQAALLTILTQIGS
FVPAESARIGLADRIFARVGASDELGRGQSTFMVEMTETARILHSATASSLVILDEIGRG
TSTYDGISLAWAITEFLHDAVGCRTFFATHYHELTQLSASLKSVMNWNVAVREHNDDVVF
MHQIVPGAADKSYGIHVGRLAGLPGVVLDRAREILKVLEAEQTDHLSQDPGKSRLPARKT
RRSREQQLTLFELAEHPILEKIRQLDVHGMSPEAAWQELARLRSELSADKG
Download sequence
Identical sequences D5SY75
gi|296124289|ref|YP_003632067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]