SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302391792|ref|YP_003827612.1| from Acetohalobium arabaticum DSM 5501

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302391792|ref|YP_003827612.1|
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily RNase III domain-like 8.55e-53
Family RNase III catalytic domain-like 0.0000368
Further Details:      
 
Domain Number 2 Region: 121-233
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.29e-27
Family Double-stranded RNA-binding domain (dsRBD) 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302391792|ref|YP_003827612.1|
Sequence length 234
Comment RNAse III [Acetohalobium arabaticum DSM 5501]
Sequence
MITAEYKEKLEELQSKIDIYFADLDLLQRALTHKSYANENRDLNLKDNERLEFLGDSVLD
IVVSEYMFNRYPDYPEGKLAKMRASVVSAPTLAAKARELDLGRYLLLGHGEEMTGGRKRS
SILADAFEALVGSIYLDQDLDIAEDFIMKLMKVDIESAEAGEHIRDYKTTLQEMIQKRSN
ARPEYYVIEEKGPDHSKEFTVEVKFNDRSLGEGTGSSKKEAQQQAAKNALKKLK
Download sequence
Identical sequences D9QPV6
WP_013277993.1.56781 gi|302391792|ref|YP_003827612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]