SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302392757|ref|YP_003828577.1| from Acetohalobium arabaticum DSM 5501

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302392757|ref|YP_003828577.1|
Domain Number 1 Region: 155-341
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.29e-61
Family Methylesterase CheB, C-terminal domain 0.00000975
Further Details:      
 
Domain Number 2 Region: 1-109
Classification Level Classification E-value
Superfamily CheY-like 2.99e-20
Family CheY-related 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302392757|ref|YP_003828577.1|
Sequence length 342
Comment response regulator receiver modulated CheB methylesterase [Acetohalobium arabaticum DSM 5501]
Sequence
MEKIKVLVIYNSPLVNNVLGKALEKNSEIELVGSATNSYLAVRKVEELKPDILILDIRMA
NMDCLQYLERFMVHHSIPVIVVSTLTTQRNKLVLKALEMGVVDFLIKPAVTTENKRNEFQ
TEVISKIKSVARANVVPKFKDDFISRELTVNKEKAILGIGASTGGFKAIKELLARFTAKM
PGIVIIQHMPQEFTSAFVRRLNHISDLEVKEAENGDRILPGQALVIPGGYESGLEKSDGN
YYLWLKNNNQSFKQQSSIDTFFTSLAAEVKDKAIGVLLTGMGNDGAKGLKQIKEAGGYTI
VQDEETSALFEMPKQAIEQGASKEVVSLDKITDGIIRVLNNQ
Download sequence
Identical sequences D9QT12
WP_013278957.1.56781 gi|302392757|ref|YP_003828577.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]