SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297526042|ref|YP_003668066.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526042|ref|YP_003668066.1|
Domain Number 1 Region: 255-612
Classification Level Classification E-value
Superfamily SIS domain 3.8e-90
Family double-SIS domain 0.00000238
Further Details:      
 
Domain Number 2 Region: 2-238
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.06e-63
Family Class II glutamine amidotransferases 0.0000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297526042|ref|YP_003668066.1|
Sequence length 612
Comment glucosamine/fructose-6-phosphate aminotransferase, isomerizing [Staphylothermus hellenicus DSM 12710]
Sequence
MCGIIGVIALPGKTPYSPGVMVYRGLLRLEYRGYDSAGVASIVGEHVRVLKGKGRIIDLE
RRIGLSSIEGLTVIGHTRWATHGTPSDRNAHPHIDCSGRIAVIHNGIIQNFRELKKILVE
KGHVFRSDTDTEVFPHLVEELYRDTNNLFEAFRKAVEMIDGSYALIMISSIEPDKIFFAK
KDSPLIIGLGIGFNILASDIPAILEYTRRIITVRDGWLGYVTPTSIHIEDIRGGVVDWRR
YIRVVEWSLEDATRGGYAHFMLKEIHEQPRALKDTYYGILHDVAVGEAVKLMHDADKIYV
TAAGTSFHASYYFSLLMSILGKRLVIPFIASEYESYYLTASDKDLLVVVSQSGETMDALK
ALRAFRNRGAGVVAVSNVVDSAIPRESNIAVYTRAGPEIGVAATKTFTTQTLVLSWLAIA
YAEASGSLSKSEADMLRGWLGRSGEVVGKIIARLEPVAKRLAEWFRSVGNAYYLSRSIGV
PVAMEGALKLKEIAYIHAEAYPAGESKHGPIALVEEGFPVIFTIPNREDLEKLLLGNIQE
MKARGAVIIGVASENTGLSDQLDYHFRIPDTHWILTPITHTPPQQLLAYYTAVSKGYDPD
KPRNLAKTVTVE
Download sequence
Identical sequences D7DAH0
gi|297526042|ref|YP_003668066.1| WP_013142365.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]