SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297526054|ref|YP_003668078.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526054|ref|YP_003668078.1|
Domain Number 1 Region: 6-115
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.57e-21
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297526054|ref|YP_003668078.1|
Sequence length 135
Comment DNA polymerase beta domain-containing protein region [Staphylothermus hellenicus DSM 12710]
Sequence
MVVEENKLLERAVNRLVKILNVKGIILFGSRARGDWMPWSDYDILIIADFKEKYLDRIKT
VLDIIGDIPLNIEPHPYTLREALDMLRKGNPLIVDALEEGKILYATNDLEEIIKEYEKLK
KKGLKRTNTTILIPK
Download sequence
Identical sequences D7DAI2
gi|297526054|ref|YP_003668078.1| WP_013142377.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]