SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297526145|ref|YP_003668169.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526145|ref|YP_003668169.1|
Domain Number 1 Region: 219-316
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000209
Family Multidrug resistance efflux transporter EmrE 0.014
Further Details:      
 
Domain Number 2 Region: 68-167
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000432
Family Multidrug resistance efflux transporter EmrE 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297526145|ref|YP_003668169.1|
Sequence length 324
Comment hypothetical protein Shell_0127 [Staphylothermus hellenicus DSM 12710]
Sequence
MLDIAIYATMWEGMVLKILISNLLEKSPIKIGRIVFYVLVFTIIFLSISVASILVLLSNA
SAVACAFWRTFLSAIILWFIKLLLNRSWVGLRNYKVLSLIVLSGVFLAAHFLFWMESLFL
VPVAISTTIVVSYPLFSLVVDKIIYNERIYGIQYIGLTTGFIGIAFFMEPRLIGEYSVSG
VILALLGAVAATGYFSIGRRVRKVVGLLEYTTIAYSSAAITLLVYSLFTGANLVHYGLNS
YIYFFLLAIIPMLGGHTLLNYVLKYIKTSSATSIALGEPVGASILAYIFLGQIITPIQIL
LIIVILLSIALVLYPEIRNITEKK
Download sequence
Identical sequences D7DAS3
WP_013142468.1.49614 gi|297526145|ref|YP_003668169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]