SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297526247|ref|YP_003668271.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526247|ref|YP_003668271.1|
Domain Number 1 Region: 237-383,410-632
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.06e-91
Family Amylase, catalytic domain 0.00000046
Further Details:      
 
Domain Number 2 Region: 40-104
Classification Level Classification E-value
Superfamily E set domains 0.000000467
Family AMPK-beta glycogen binding domain-like 0.032
Further Details:      
 
Domain Number 3 Region: 641-706
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000989
Family alpha-Amylases, C-terminal beta-sheet domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|297526247|ref|YP_003668271.1|
Domain Number - Region: 191-240
Classification Level Classification E-value
Superfamily E set domains 0.0644
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297526247|ref|YP_003668271.1|
Sequence length 713
Comment alpha amylase catalytic subunit [Staphylothermus hellenicus DSM 12710]
Sequence
MVETQDVKETILAWLNGKMYIIIRREIYGKGRKGRYIVKFTRHWPPNAKNIYLIGEFTSL
YPGFVKLRKIGEQGIVYLKLWPGEYGYGFQIDNDFENIYDPDNEEKKCVYTSFFPEYRKC
LSKLTIREPSNPLDRIIHIEEPGFIHRFNNEIIIRLIAPREINDPLIDLGKEIREPSTKY
VLGNNIVYQYIVPNRSVLRYRFIFNYNDKTLFYGDEGVSTNSSYIVVDTTSIPGVDEPRW
YMGTLYYQIFIDSFENGDPKNDPPNKIRRIIPREHGYYGGDLAGIMKHIDHLEDLGVETI
YLTPIFPSTSYHRYDTIDYKSIDKYLGSMKDFEKLVRKLHDKKIKIILDITMHHTNPCNK
LFVKALREGENSPYWEMFSFLSPLPKEVAELVLKYIGGEECRSRELYRHDYFKNNKPFYE
AFFNIWLMAKFNHDNPETVDYFLDITKFWVDKGVDGFRIDVAMGIHYSWIKQYYEYVKNT
YPDFLVLGELAENPRIYMNYYDSAMNYYLRKAILELFIYKRIGLNEFISRINSMYAYIPH
YKALSLYNMLGSHDVPRIKSIVQNNKLLKLMYVLIFALPGSPVIYYGDEIGLEGGRDPDN
RRPMNWDRGSWDLELYEHIKKLIRIHKSCRSIRHGYFSAENWDNNLLLIKRWINDEETIF
ILNISKQNISIDLGKLGKYRFDIYSGNSIDQHVNNVLLREYGFLILGSKPCNI
Download sequence
Identical sequences D7DB25
gi|297526247|ref|YP_003668271.1| WP_013142570.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]