SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297526259|ref|YP_003668283.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526259|ref|YP_003668283.1|
Domain Number 1 Region: 141-360
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 8.77e-65
Family Creatinase/aminopeptidase 0.0000117
Further Details:      
 
Domain Number 2 Region: 3-141
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.000000488
Family Creatinase/prolidase N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297526259|ref|YP_003668283.1|
Sequence length 368
Comment peptidase M24 [Staphylothermus hellenicus DSM 12710]
Sequence
MKPQINKLYELVEKSGVEEVLLAAPDNIEYFLGIRTIADSVLLLHYKKGGNLRIYVPLLE
YYRFRDTLSKLGVEVIAVSKTVKPSDARIVESDWKTLIGKLASSDKVGFDKSHVSPLNTL
ITSIYGDRIVDLSSEINKYRMRKEDWEIKSITRAVEITGKGIYEVANNLNDRITEAEVAG
FFEYRVRREGVDEYAFPPLTLFKPGNSYPHNLPSNTRLGRKNLVLVDVGVKYNGRCSDIT
RMIIWRKISEEERKAVEAVNEAVDNVIDNIQPGIEAGKLADIAVKTLEKHGLSERFIHGL
GHGFGVLVHEPPYIRIGEKTKLEPGMVFTVEPGVYFAGKYGVRIEEDVLVTERGVRVLSK
MIERIITP
Download sequence
Identical sequences D7DB37
gi|297526259|ref|YP_003668283.1| WP_013142582.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]