SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297526348|ref|YP_003668372.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526348|ref|YP_003668372.1|
Domain Number 1 Region: 20-256
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 3.8e-74
Family Purine and uridine phosphorylases 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297526348|ref|YP_003668372.1|
Sequence length 289
Comment uridine phosphorylase [Staphylothermus hellenicus DSM 12710]
Sequence
MERGKKLSSASAPVDESGRVYHLGVKPGDVSKYVLLPGDPGRVKRIASFWDKAWRVAEHR
EYLTFSGRYKGVFISATSTGIGSPSTAIAVEELARVGSTTFIRVGTTGALNRNIGVGDII
ISTGAVRFEGTSKQYVFPEYPAVASFDVTLALITAAEELGVKYHVGLTVSSDSFYVGQER
PGYKGYLPPFQRGLIDFLRSVNVLNFEMEAAAIFTLANIYGLRAGSVCAAIANRETEEFI
VDAGVDDAIKVANEAVKILSEWDQIVGETGSKTVSAKTILEWYKRIGRL
Download sequence
Identical sequences D7DBC6
WP_013142671.1.49614 gi|297526348|ref|YP_003668372.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]