SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297526354|ref|YP_003668378.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526354|ref|YP_003668378.1|
Domain Number 1 Region: 111-386
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 7.95e-75
Family NadC C-terminal domain-like 0.000000194
Further Details:      
 
Domain Number 2 Region: 2-114
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.22e-30
Family NadC N-terminal domain-like 0.0000836
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297526354|ref|YP_003668378.1|
Sequence length 391
Comment Quinolinate phosphoribosyl transferase [Staphylothermus hellenicus DSM 12710]
Sequence
MRLYVASEKEIVDGAVSDIYFVRTTRILREKGVRRKVRMEYHTTSLPKGYEWAVYAGLEE
ILYVLKDKPVTVYSLPEGTLFKPGEPLLIIEGYYDDIAVYETALLGIMRHYTSIATKAAR
MKRLAIDKTLLFFGLRALHPALAPMADRAAYIGGLDAVSGAISEKYLGLKPVGTMPHALI
IVFGDQVKAWKAFDEVVEEGVPRIMLVDTFCDERMESLLAAKVLGKKLYGVRLDTPSSRR
GNMRKIVEEVRWTLDIHGYKHVKIIVSGGIGEKELVELRDIVDSFGIGTSISFPKSIDIS
ADIVEIYDNGEWIPVSKRGKLPGAKQLYRRRPGLNDYIGLLNRSTPPSPDYKPLLKKYID
NGELIEKLPSIQEIRNYVLEQLREVPEPEPV
Download sequence
Identical sequences D7DBD2
gi|297526354|ref|YP_003668378.1| WP_013142677.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]