SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297526455|ref|YP_003668479.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526455|ref|YP_003668479.1|
Domain Number 1 Region: 5-136
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.8e-26
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0038
Further Details:      
 
Domain Number 2 Region: 145-253
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 0.0000000000000144
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297526455|ref|YP_003668479.1|
Sequence length 256
Comment molybdopterin dehydrogenase FAD-binding protein [Staphylothermus hellenicus DSM 12710]
Sequence
MIRDRRIPIPKHLVDLNAIKRELSFVEKKDDGIHIGGGTTLYELSQTFLHKDKRFAGFVD
VYKKFGTLALRFEATIAGNLVSATQYNDYITLLLVYDAKLRLVSANGERIVRLEDFLIDK
RKVDLKPNELIYEIIFSEPPMNSSSSFIKFDRRELLIAGVVTGAAFLALEDNKIADVKIS
FDMVREKRIPGRARKSEEFLKGKEFSEEILEKVAEEVLPTEMERVTDWWTNAEYRMDMSK
VVLKRNLLRAYKRIKG
Download sequence
Identical sequences D7DBN3
WP_013142778.1.49614 gi|297526455|ref|YP_003668479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]