SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297526644|ref|YP_003668668.1| from Staphylothermus hellenicus DSM 12710

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297526644|ref|YP_003668668.1|
Domain Number 1 Region: 9-122,226-422
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 6.8e-100
Family Substrate-binding domain of HMG-CoA reductase 0.000000141
Further Details:      
 
Domain Number 2 Region: 115-221
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 4.97e-31
Family NAD-binding domain of HMG-CoA reductase 0.0000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297526644|ref|YP_003668668.1|
Sequence length 428
Comment hydroxymethylglutaryl-CoA reductase [Staphylothermus hellenicus DSM 12710]
Sequence
MSHEMRSSRIPGFYKKSLDERLRIVGEWAGLTEEEVNLLRNLGNLPEKIADSMIENVIGG
MTYPFAVAVNFKINGRDYLVPMVIEETSVVAAASNAAKMLRRGRGIIVRAGPQEMIGQIH
LVNVEAPYYKAMKILEHKEEIIDHAKQQDSTLIKLGGGPRDLEVRVLNTRMGPVIVVHLI
VDVLDAMGANAVNTMVESIAPLLEKITGGEARLRIISNYATRRIVRALARTDPEDVGGKD
VARKIVEASILAEADPYRAVTHNKGIMNGIIAVALATAQDHRAIEAGAHAYAARSGVYKP
LSTWELDEEGMLVGSLELPLQVGIVGGATKVHPIAKIALKILGVKTAKELAEIMAAVGLA
QNLAALRALVHEGIQKGHMRLHARNLAIMAGATGELIDKIAERMIGEGKIRYDYAKKLLE
EYLKGENK
Download sequence
Identical sequences D7DC72
gi|297526644|ref|YP_003668668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]